PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G25990.1
Common NameGT-4, MPE11.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 372aa    MW: 42782.9 Da    PI: 5.7598
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G25990.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.69.4e-3055139286
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  W ++e+++Li +rrem++ ++++k++k+lWe++skkmre+gf rsp +C++kw+n+ k++kk k++e k ts+ s++++y++++e
  AT3G25990.1  55 WAQDETRTLISLRREMDNLFNTSKSNKHLWEQISKKMREKGFDRSPSMCTDKWRNILKEFKKAKQHEDKATSGGSTKMSYYNEIE 139
                  ***********************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.89747111IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.4E-548113IPR009057Homeodomain-like
SMARTSM007172.8E-551113IPR001005SANT/Myb domain
CDDcd122031.80E-2853118No hitNo description
PfamPF138371.8E-2054140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020090anatomyembryo sac central cell
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MFVSDNNNPS RDINMMIGDV TSNGDLQPHQ IILGESSGGE DHEIIKAPKK RAETWAQDET  60
RTLISLRREM DNLFNTSKSN KHLWEQISKK MREKGFDRSP SMCTDKWRNI LKEFKKAKQH  120
EDKATSGGST KMSYYNEIED IFRERKKKVA FYKSPATTTP SSAKVDSFMQ FTDKGFEDTG  180
ISFTSVEANG RPTLNLETEL DHDGLPLPIA ADPITANGVP PWNWRDTPGN GVDGQPFAGR  240
IITVKFGDYT RRVGIDGTAE AIKEAIRSAF RLRTRRAFWL EDEEQVIRSL DRDMPLGNYI  300
LRIDEGIAVR VCHYDESDPL PVHQEEKIFY TEEDYRDFLA RRGWTCLREF DAFQNIDNMD  360
ELQSGRLYRG MR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A7e-4249137186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.372910.0bud| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258068_at0.0
Expression AtlasAT3G25990-
AtGenExpressAT3G25990-
ATTED-IIAT3G25990-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. GT-4 interacts with TEM2 and then co-regulates the salt responsive gene Cor15A to improve salt stress tolerance.
    [PMID: 25465615]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00380DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G25990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G25990, AT1G68840
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G25990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0723700.0AB072370.1 Arabidopsis thaliana mRNA for transcription factor GT-4, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189228.10.0trihelix transcription factor GT-4
SwissprotQ9LU920.0TGT4_ARATH; Trihelix transcription factor GT-4
TrEMBLD7LQX50.0D7LQX5_ARALL; Putative uncharacterized protein
STRINGAT3G25990.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Representative plantOGRP59331318
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ayadi M,Delaporte V,Li YF,Zhou DX
    Analysis of GT-3a identifies a distinct subgroup of trihelix DNA-binding transcription factors in Arabidopsis.
    FEBS Lett., 2004. 562(1-3): p. 147-54
    [PMID:15044016]
  3. De Paepe A,Vuylsteke M,Van Hummelen P,Zabeau M,Van Der Straeten D
    Transcriptional profiling by cDNA-AFLP and microarray analysis reveals novel insights into the early response to ethylene in Arabidopsis.
    Plant J., 2004. 39(4): p. 537-59
    [PMID:15272873]
  4. Park HC, et al.
    Pathogen- and NaCl-induced expression of the SCaM-4 promoter is mediated in part by a GT-1 box that interacts with a GT-1-like transcription factor.
    Plant Physiol., 2004. 135(4): p. 2150-61
    [PMID:15310827]
  5. Rohde A, et al.
    Molecular phenotyping of the pal1 and pal2 mutants of Arabidopsis thaliana reveals far-reaching consequences on phenylpropanoid, amino acid, and carbohydrate metabolism.
    Plant Cell, 2004. 16(10): p. 2749-71
    [PMID:15377757]
  6. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  7. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  8. Wang XH, et al.
    Trihelix transcription factor GT-4 mediates salt tolerance via interaction with TEM2 in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 339
    [PMID:25465615]